Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension

Product Details
Customization: Available
Powder: Yes
Customized: Customized
Still deciding? Get samples of $ !
Request Sample
Gold Member Since 2020

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

Fast Delivery
The supplier can deliver the goods within 15 days
Customization from Samples
The supplier provides sample based customization services
High Repeat Buyers Choice
More than 50% of buyers repeatedly choose the supplier
R&D Capabilities
The supplier has 1 R&D engineers, you can check the Audit Report for more information
to see all verified strength labels (11)
  • Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
  • Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
  • Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
  • Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
  • Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
  • Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Find Similar Products

Basic Info.

Model NO.
YH-FOXO4 DRI
Certification
GMP, HSE, ISO 9001, USP, BP
Suitable for
Elderly, Adult
State
Solid
Purity
>99%
CAS
34973-08-5
MOQ
1g
Sample
Free
Appearance
White Fine Powder
Test Method
HPLC, Hnmr, LC-Ms, UV, IR
Shelf Life
2 Years
Grade
Pharmaceutical Grade
Function
Auxiliaries and Other Medicinal Chemicals
Application
Capsules, Tablets, Pills
Storage
Keep It in Stored Desiccated Below -18° C
Delivery
7-10days by TNT, FedEx, EMS, DHL
Transport Package
1g/Vial
Specification
99%
Trademark
Yinherb
Origin
China
Production Capacity
500GS Per Month

Product Description

Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension

Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Yinherb FOXO4-D-Retro-Inverso(DRI) Custom peptide Peptide Bulk powder
Name:FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide                        
acetate (salt), Synthetic luteinizing hormone-releasing factor acetate
Appearance :White powder
Purity (HPLC)  >98.0%
Single Impurity(HPLC) :1.0%max
Amino Acid Composition :±10% of theoretical
Peptide Content(N%) :≥80.0% 
Water Content(Karl Fischer): ≤8.0%
Acetate Content(HPIC): ≤12.0%
MS(ESI): Consistent
Mass Balance: 95.0~105.0% 
Bacterial Endotoxins :≤5EU/mg
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension

What is FOXO4-D-Retro-Inverso(DRI) Custom Peptide?
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Epithalon Peptide HPLC &NMR Test report by Yinherb 
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life ExtensionYinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension

Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension

Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Yinherb Foxo4-D-Retro-Inverso (DRI) Custom Peptide Senolytics Peptide for Life Extension
Q1: Can i get some samples 
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments 

A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, Western Union or Paypal or Escrow(******).
 
Q3: How to confirm the Product Quality before placing orders 

A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What's your MOQ 

A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
 
Q5: How about delivery leadtime 

A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
 
Q6:Is there a discount 

A:Different quantity has different discount.
 
Q7: How do you treat quality complaint 

A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier