Yinherb Supply 98% Pure CAS: 47931-85-1 pure Calcitonin Acetate Salmon
Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
What is Calcitonin Salmon Acetate?
Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.
The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
Calcitonin Salmon Acetate Benefits
Salmon calcitonin, inhibit the activity of osteoclasts,Inhibit bone salt dissolving, prevent bone calcium release;Improve bone mineral density, effectively relieve pain symptoms;Reduce the risk of fractures;Lower blood calcium.
Calcitonin Salmon Acetate Dosage
This depends on your body weight. All of the research carried out so far has used rodent studies, the rats and mice are usually injected with an effective dosage thought to be around 10 μg (mcg) per KG, in humans this is thought to be around the equivalent loading of 1.6 μg per KG in humans, so if you are:
60 KG (132 lb.) then your ideal daily oral dose would be 96 μg (mcg)
70 KG (154 lb.) => 112 μg
80 KG (176 lb.) => 128 μg
90 KG (198 lb.) => 144 μg
Calcitonin Salmon Acetate HPLC &NMR Test report by Yinherb

Q1: Can i get some samples
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, Western Union or Paypal or Escrow.
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
Q4:What's your MOQ
A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
Q5: How about delivery leadtime
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q6:Is there a discount
A:Different quantity has different discount.
Q7: How do you treat quality complaint
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.